PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf00165g05008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 414aa    MW: 46393 Da    PI: 8.9166
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf00165g05008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.1e-091221591954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Niben101Scf00165g05008.1 122 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 159
                               554459******************************88 PP

2BELL87.91.1e-281541972
                      BELL 19 VdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                              V++rY+qy++q+q++++sFe++ag+gsak+Yt+lAl++iS++FrcLkdai++qi
  Niben101Scf00165g05008.1  1 VEQRYRQYHHQMQIIVASFEEAAGIGSAKSYTQLALHTISKQFRCLKDAITGQI 54
                              89***************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075267.8E-23151IPR006563POX domain
SMARTSM005749.1E-4152IPR006563POX domain
PROSITE profilePS5007112.05100163IPR001356Homeobox domain
CDDcd000861.22E-11103164No hitNo description
SMARTSM003894.2E-10103167IPR001356Homeobox domain
SuperFamilySSF466892.57E-17104170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-29106169IPR009057Homeodomain-like
PfamPF059201.4E-18120159IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
VEQRYRQYHH QMQIIVASFE EAAGIGSAKS YTQLALHTIS KQFRCLKDAI TGQIKATSKS  60
LGEEEINLGG KIEGSSSRLR FVDHHLRQQR ALQQLGMMQP NAWRPQRGLP ERAVSVLRAW  120
LFEHFLHPYP KDSDKIMLAK QTGLTRSQVS NWFINARVRL WKPMVEEMYL EEVKNNQEQN  180
GLLEENAKKN NEPNKEMCTK SSAPQETPNP RKDKQISSIL QDASPTEISS STISTSPTGG  240
SFPAQAAGFS FIGSLNMENS TSERNNKKAR NDMQNSSSSI LSMETEIKAG DTIKGGKFNG  300
DNRQARDQSY PLMTAYSTMG EFGRFNPEQQ MATSFQGNGV SLTLGLPPSE NLVLSGSQHN  360
FLPSQNIGIE MGRIETHYNI MSNPQPSHPN INYENIDFQS GKRYAAQLLP DFVS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B2e-16109167563Homeobox protein Meis2
3k2a_A2e-16109167563Homeobox protein Meis2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1207214PNPRKDKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009778871.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778870.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_009778869.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478052.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478051.10.0PREDICTED: BEL1-like homeodomain protein 1
RefseqXP_016478049.10.0PREDICTED: BEL1-like homeodomain protein 1
SwissprotQ9SJ561e-100BLH1_ARATH; BEL1-like homeodomain protein 1
TrEMBLM1BQG31e-167M1BQG3_SOLTU; Uncharacterized protein
TrEMBLQ8LLE31e-168Q8LLE3_SOLTU; BEL1-related homeotic protein 11 (Fragment)
STRINGPGSC0003DMT4000505271e-167(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-79BEL1-like homeodomain 1